DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and AT2G22100

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_565526.1 Gene:AT2G22100 / 816745 AraportID:AT2G22100 Length:382 Species:Arabidopsis thaliana


Alignment Length:258 Identity:69/258 - (26%)
Similarity:96/258 - (37%) Gaps:51/258 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 RTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKR 156
            :|.|....:.....:|.:..::.:.:||.||..|...|.|:..|:.:|:|...::|.|||||:.:
plant   140 KTAEKGSKLISAVFESADRDSSQRNIFVRGLGWDTTHENLKAAFEVYGEITECSVVMDKDTGRAK 204

  Fly   157 GFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKA----------------IAKQDMDRQGGGGGR 205
            ||.|:.|.........:......:.|:|:....|                ..|.|:...|.....
plant   205 GFGFVLFKTRKGARAALKNPEKRMYNRTVSCLPARPFNSGKPREQQQPVESVKIDLSHTGNQSEM 269

  Fly   206 GGPRAGGRGGQG-DRG----QGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGN--FGGGQG---G 260
            ..|  |...|.| |:|    |....:.|||....|.:....|....:|...||  ..|.|.   .
plant   270 ALP--GIDLGHGLDKGHQQQQNMSMYAGQNMPFYGHSQPPPGFNPMYGAMMGNPMVAGLQNYRMF 332

  Fly   261 GSGGWNQQGGSGGGPW---NNQGGGNGGWNGGGGGGY-GGGNSNGSWGGNGGGGGGGGGFGNE 319
            |||..||      ||.   |:.         |..|.| |.||.||.    |.|.|.|.||..|
plant   333 GSGMMNQ------GPMMPPNHM---------GMVGQYVGDGNVNGV----GAGAGAGAGFDGE 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 2/9 (22%)
RRM_SF 116..188 CDD:302621 22/71 (31%)
AT2G22100NP_565526.1 PABP-1234 <164..>353 CDD:130689 52/205 (25%)
RRM_SF 165..235 CDD:418427 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.