DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and rbm19

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_012825334.1 Gene:rbm19 / 733862 XenbaseID:XB-GENE-922190 Length:920 Species:Xenopus tropicalis


Alignment Length:183 Identity:51/183 - (27%)
Similarity:75/183 - (40%) Gaps:49/183 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DDGEEITEPEQLR--KLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRS---RGFGFIT 71
            :|.|| .|.|.|.  .|||..|::.|:::.||..|.|.|.:....:.|......|   .||||:.
 Frog   682 EDQEE-DEEEALPGCTLFIKNLNFSTSEETLKEIFSKVGAVKSCSISKKKDKSGSLLPMGFGFVE 745

  Fly    72 YSQSYMIDNAQNA----RPHKIDGRTVEPK------RAVPRQEIDSPNA---------------G 111
            |::.   :.||.|    :...:||..||.|      ||....|....|:               .
 Frog   746 YTKP---EQAQKALRQLQKCTVDGHQVEIKLSERAIRAATSTERKKQNSKKQQSSKILVRNVPFQ 807

  Fly   112 ATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSD-KDTGKKRGFAFIEF 163
            |||::              :||.|..||::.:|.:... ..||..|||.|::|
 Frog   808 ATVRE--------------IRELFSTFGELKTVRLPKKMAGTGSHRGFGFVDF 846

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 27/89 (30%)
RRM_SF 116..188 CDD:302621 13/49 (27%)
rbm19XP_012825334.1 RRM1_RBM19 2..77 CDD:241008
RRM2_RMB19 279..350 CDD:240946
RRM3_RBM19 384..462 CDD:241011
RRM4_RBM19 570..641 CDD:241013
RRM5_RBM19_like 695..774 CDD:240764 25/81 (31%)
RRM6_RBM19 797..875 CDD:241015 16/64 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.