DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and Slirp

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001102977.1 Gene:Slirp / 688717 RGDID:1585290 Length:111 Species:Rattus norvegicus


Alignment Length:76 Identity:20/76 - (26%)
Similarity:35/76 - (46%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDG 91
            ||..:.:......|:.||.::|::....|..|.:|...||.|::.:|....:.||.....|.|||
  Rat    22 FIRKIPWTAASSELREHFAQFGHVRRCTVPFDKETGFHRGMGWVQFSSQEELQNALQEEHHIIDG 86

  Fly    92 RTVEPKRAVPR 102
            ..:..:...|:
  Rat    87 VEIHVQPQKPK 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 19/74 (26%)
RRM_SF 116..188 CDD:302621
SlirpNP_001102977.1 RRM_SLIRP 21..92 CDD:409688 19/69 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.