DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and Pabpc6

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001157308.1 Gene:Pabpc6 / 67543 MGIID:1914793 Length:643 Species:Mus musculus


Alignment Length:197 Identity:51/197 - (25%)
Similarity:92/197 - (46%) Gaps:36/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LRK-----LFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQ 82
            |||     :|:..||.......|...|..:|||:...|:.|  ...|:|:||:.:...   :.|:
Mouse    93 LRKSGVGNIFVKNLDRSIDSKTLYDTFSAFGNILSCKVVCD--ENGSKGYGFVHFETQ---EEAE 152

  Fly    83 NA---------RPHKIDGRTVEPKRAVPRQEIDSPNAGATVKK---LFVGGLRDDHDEECLREYF 135
            .|         ..||:.....:.:|  .||    ...||..|:   :::..|.:|.|:|.|::.|
Mouse   153 RAIEKMNGMFLNDHKVFVGRFKSRR--DRQ----AELGARAKEFTNVYIKNLGEDMDDERLQDLF 211

  Fly   136 KDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAI---AKQDMD 197
            ..||..:||.:::| ::||.:||.|:.|:.::...|.:    ..:..|.|:.|:..   |::.::
Mouse   212 GRFGPALSVKVMTD-ESGKSKGFGFVSFERHEDARKAV----EEMNGKDLNGKQIYVGRAQKKVE 271

  Fly   198 RQ 199
            ||
Mouse   272 RQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 20/90 (22%)
RRM_SF 116..188 CDD:302621 20/74 (27%)
Pabpc6NP_001157308.1 PABP-1234 11..622 CDD:130689 51/197 (26%)
RRM1_I_PABPs 12..91 CDD:240824
RRM2_I_PABPs 97..172 CDD:240825 18/79 (23%)
RRM3_I_PABPs 190..269 CDD:240826 22/83 (27%)
RRM4_I_PABPs 303..380 CDD:240827
PABP 554..621 CDD:279051
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.