DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and BOLL

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001271290.1 Gene:BOLL / 66037 HGNCID:14273 Length:339 Species:Homo sapiens


Alignment Length:135 Identity:37/135 - (27%)
Similarity:64/135 - (47%) Gaps:17/135 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 QNARPHKIDGRTVEPKRAVP---RQEIDSPNAGATV-KKLFVGGLRDDHDEECLREYFKDFGQIV 142
            |.:...:.|..:..|....|   .....:|..|..: .::||||:....:|..||::|..:|.:.
Human     2 QTSNQMQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVK 66

  Fly   143 SVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSI--KNKTLDVKKAIAKQDMDRQGGGGGR 205
            .|.||:|: .|..:|:.|:.|:..:...| |||:...:  |:|.|::..||.||.:         
Human    67 EVKIVNDR-AGVSKGYGFVTFETQEDAQK-ILQEAEKLNYKDKKLNIGPAIRKQQV--------- 120

  Fly   206 GGPRA 210
            |.||:
Human   121 GIPRS 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 4/22 (18%)
RRM_SF 116..188 CDD:302621 24/73 (33%)
BOLLNP_001271290.1 RRM_BOULE 37..117 CDD:241117 26/81 (32%)
RRM <38..>119 CDD:223796 27/82 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.