DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and Trnau1ap

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_075416.1 Gene:Trnau1ap / 65241 RGDID:619995 Length:287 Species:Rattus norvegicus


Alignment Length:147 Identity:35/147 - (23%)
Similarity:69/147 - (46%) Gaps:12/147 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LFIGGLDYRTTDDGLKAHFEKWG-NIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKI 89
            |::|.|:....::.:...|...| .::.|.::::..|....|:.|:.::.   :..|:... |||
  Rat     5 LWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFAD---LATAEKCL-HKI 65

  Fly    90 DGRTVEPKRAVPRQEIDSPNAG-----ATVKKLFVGGLRDDHDEECLREYF-KDFGQIVSVNIVS 148
            :|:.:.......|.:::....|     :....||||.|..|.|:..|.|:| |.:.......:|.
  Rat    66 NGKPLPGATPAKRFKLNYATYG
KQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVL 130

  Fly   149 DKDTGKKRGFAFIEFDD 165
            |: ||..:|:.|::|.|
  Rat   131 DQ-TGVSKGYGFVKFTD 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 14/76 (18%)
RRM_SF 116..188 CDD:302621 19/51 (37%)
Trnau1apNP_075416.1 RRM1_SECp43 4..87 CDD:410022 15/85 (18%)
RRM2_SECp43 95..176 CDD:410024 19/53 (36%)
Trnau1ap <205..284 CDD:407550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.