DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and SRSF2

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001182356.1 Gene:SRSF2 / 6427 HGNCID:10783 Length:221 Species:Homo sapiens


Alignment Length:87 Identity:29/87 - (33%)
Similarity:46/87 - (52%) Gaps:1/87 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMI 78
            |....:.|.:..|.:..|.|||:.|.|:..|||:|.:.||.:.:|..||.||||.|:.:......
Human     4 GRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDA 68

  Fly    79 DNAQNARPHKI-DGRTVEPKRA 99
            ::|.:|....: |||.:..:.|
Human    69 EDAMDAMDGAVLDGRELRVQMA 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 27/76 (36%)
RRM_SF 116..188 CDD:302621
SRSF2NP_001182356.1 RRM_SRSF2_SRSF8 16..88 CDD:409751 26/71 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..221
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.