DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and RBMS2

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_006719604.1 Gene:RBMS2 / 5939 HGNCID:9909 Length:477 Species:Homo sapiens


Alignment Length:229 Identity:66/229 - (28%)
Similarity:92/229 - (40%) Gaps:46/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SNGNYDDGEEITEPEQLRK--LFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGF 69
            ||||          :||.|  |:|.||...|||..|....:.:|.||....:.|..|.:.:|:||
Human    47 SNGN----------DQLSKTNLYIRGLQPGTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGF 101

  Fly    70 ITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREY 134
            :.:........|..|.  |..|  |:.:.| .:||.|..|       |::..|....||:.|...
Human   102 VDFDSPSAAQKAVTAL--KASG--VQAQMA-KQQEQDPTN-------LYISNLPLSMDEQELEGM 154

  Fly   135 FKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAI-AKQD--- 195
            .|.|||::|..|:.| .:|..||..|...:..:..:.||   || ...|.:.....: |..|   
Human   155 LKPFGQVISTRILRD-TSGTSRGVGFARMESTEKCEAII---TH-FNGKYIKTPPGVPAPSDPLL 214

  Fly   196 ---MDRQGGGGGRGGPRAGGRGGQGDRGQGGGGW 226
               .|        |||:.  |..||...|.|..|
Human   215 CKFAD--------GGPKK--RQNQGKFVQNGRAW 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 23/78 (29%)
RRM_SF 116..188 CDD:302621 21/71 (30%)
RBMS2XP_006719604.1 RRM1_MSSP1 49..134 CDD:240914 29/99 (29%)
RRM2_MSSP2 135..220 CDD:240918 25/104 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.