DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and DAZ4

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001375413.1 Gene:DAZ4 / 57135 HGNCID:15966 Length:723 Species:Homo sapiens


Alignment Length:249 Identity:51/249 - (20%)
Similarity:99/249 - (39%) Gaps:84/249 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPH--- 87
            :|:||:|.|..:..:.:.|.::|::.:|.::.: :|..|:|:||:::.....:.....::.|   
Human    42 VFVGGIDARMDETEIGSCFGRYGSVKEVKIITN-RTGVSKGYGFVSFVNDVDVQKIVGSQIHFHG 105

  Fly    88 ------------KIDGRTVEPKRAV---------------PRQEI-------------------- 105
                        |:..|.|:|:..|               |..|.                    
Human   106 KKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQSAAN 170

  Fly   106 -DSPNAGATVKK--------------------------LFVGGLRDDHDEECLREYFKDFGQIVS 143
             ::||  :|:.:                          :||||:....||..:...|..:|.:..
Human   171 PETPN--STISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKE 233

  Fly   144 VNIVSDKDTGKKRGFAFIEF-DDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDM 196
            |.|:::: ||..:|:.|:.| :|.| |.||:..:.| ...|.|.:..||.||.:
Human   234 VKIITNR-TGVSKGYGFVSFVNDVD-VQKIVGSQIH-FHGKKLKLGPAIRKQKL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 19/105 (18%)
RRM_SF 116..188 CDD:302621 23/98 (23%)
DAZ4NP_001375413.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
RRM_DAZL 35..116 CDD:410073 14/74 (19%)
PABP-1234 42..412 CDD:130689 51/249 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..192 3/30 (10%)
RRM_DAZL 200..281 CDD:410073 25/83 (30%)
Daz 407..427 CDD:408642
Daz 431..451 CDD:408642
Daz 455..475 CDD:408642
Daz 479..499 CDD:408642
Daz 503..523 CDD:408642
Daz 527..547 CDD:408642
Daz 551..571 CDD:408642
Daz 575..595 CDD:408642
Daz 599..619 CDD:408642
Daz 623..643 CDD:408642
Daz 647..667 CDD:408642
Daz 671..691 CDD:408642
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.