Sequence 1: | NP_001163602.1 | Gene: | Hrb87F / 48535 | FlyBaseID: | FBgn0004237 | Length: | 385 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001375413.1 | Gene: | DAZ4 / 57135 | HGNCID: | 15966 | Length: | 723 | Species: | Homo sapiens |
Alignment Length: | 249 | Identity: | 51/249 - (20%) |
---|---|---|---|
Similarity: | 99/249 - (39%) | Gaps: | 84/249 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 LFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPH--- 87
Fly 88 ------------KIDGRTVEPKRAV---------------PRQEI-------------------- 105
Fly 106 -DSPNAGATVKK--------------------------LFVGGLRDDHDEECLREYFKDFGQIVS 143
Fly 144 VNIVSDKDTGKKRGFAFIEF-DDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDM 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hrb87F | NP_001163602.1 | RRM1_hnRNPA_like | 25..102 | CDD:241022 | 19/105 (18%) |
RRM_SF | 116..188 | CDD:302621 | 23/98 (23%) | ||
DAZ4 | NP_001375413.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..27 | ||
RRM_DAZL | 35..116 | CDD:410073 | 14/74 (19%) | ||
PABP-1234 | 42..412 | CDD:130689 | 51/249 (20%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 163..192 | 3/30 (10%) | |||
RRM_DAZL | 200..281 | CDD:410073 | 25/83 (30%) | ||
Daz | 407..427 | CDD:408642 | |||
Daz | 431..451 | CDD:408642 | |||
Daz | 455..475 | CDD:408642 | |||
Daz | 479..499 | CDD:408642 | |||
Daz | 503..523 | CDD:408642 | |||
Daz | 527..547 | CDD:408642 | |||
Daz | 551..571 | CDD:408642 | |||
Daz | 575..595 | CDD:408642 | |||
Daz | 599..619 | CDD:408642 | |||
Daz | 623..643 | CDD:408642 | |||
Daz | 647..667 | CDD:408642 | |||
Daz | 671..691 | CDD:408642 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |