DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and Pabpn1

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_062275.1 Gene:Pabpn1 / 54196 MGIID:1859158 Length:302 Species:Mus musculus


Alignment Length:86 Identity:24/86 - (27%)
Similarity:43/86 - (50%) Gaps:3/86 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMID 79
            ||..|.: .|.:::|.:||..|.:.|:|||...|::..|.::.|..:...:||.:|.:|....:.
Mouse   160 EEKMEAD-ARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR 223

  Fly    80 NAQNARPHKIDGRTVE--PKR 98
            .:.........||.::  |||
Mouse   224 TSLALDESLFRGRQIKVIPKR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 20/76 (26%)
RRM_SF 116..188 CDD:302621
Pabpn1NP_062275.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..111
Interaction with SKIP. /evidence=ECO:0000250 2..141
RRM 109..>285 CDD:223796 24/86 (28%)
Stimulates PAPOLA. /evidence=ECO:0000250 115..143
RRM_II_PABPN1 169..244 CDD:240994 18/74 (24%)
Strong poly(A) affinity and self-association. /evidence=ECO:0000250 255..302
Interaction with PAPOLA. /evidence=ECO:0000250 282..302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.