DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and Nono

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_030107241.1 Gene:Nono / 53610 MGIID:1855692 Length:482 Species:Mus musculus


Alignment Length:151 Identity:40/151 - (26%)
Similarity:65/151 - (43%) Gaps:36/151 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARP 86
            |..:||:|.|....|::.::..|||:|...:|.:.||      :|||||                
Mouse    74 QRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKD------KGFGFI---------------- 116

  Fly    87 HKIDGRTVEPKRAVPRQEIDS-PNAGATVK--------KLFVGGLRDDHDEECLREYFKDFGQIV 142
             :::.||:   ..:.:.|:|: |..|..::        .|.|..|......|.|.|.|..|||:.
Mouse   117 -RLETRTL---AEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVE 177

  Fly   143 SVNIVSDKDTGKKRGFAFIEF 163
            ...::.| |.|:..|...:||
Mouse   178 RAVVIVD-DRGRPSGKGIVEF 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 19/76 (25%)
RRM_SF 116..188 CDD:302621 16/48 (33%)
NonoXP_030107241.1 RRM1_p54nrb 75..145 CDD:241032 23/95 (24%)
RRM_SF 151..230 CDD:388407 16/48 (33%)
NOPS_p54nrb_PSF_PSPC1 221..313 CDD:240581
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.