DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and SC35

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster


Alignment Length:276 Identity:55/276 - (19%)
Similarity:83/276 - (30%) Gaps:112/276 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SNGNYDDGEEITEP----EQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGF 67
            |||....|.....|    :.:..|.:..|.||||.:.|:..||:.|.:.|:.:.:|..|:.||||
  Fly     2 SNGGGAGGLGAARPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 66

  Fly    68 GFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLR 132
            .|:.:......::|..|    :|||.::.:.                                ||
  Fly    67 AFVRFYDKRDAEDALEA----MDGRMLDGRE--------------------------------LR 95

  Fly   133 EYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMD 197
            .....:|:..|   .:...:|::.|                                        
  Fly    96 VQMARYGRPSS---PTRSSSGRRGG---------------------------------------- 117

  Fly   198 RQGGGGGRGGPR------------AGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNS 250
              |||||.||.|            ...|.....|.:..|....:.|..             |..|
  Fly   118 --GGGGGSGGRRRSRSRSPMRRRSRSPRRRSYSRSRSPGSHSPERRSK-------------FSRS 167

  Fly   251 --GGNFGGGQGGGSGG 264
              .|:...|.|.||||
  Fly   168 PVRGDSRNGIGSGSGG 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 23/76 (30%)
RRM_SF 116..188 CDD:302621 6/71 (8%)
SC35NP_001188794.1 RRM <24..>100 CDD:223796 25/111 (23%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 25/107 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.