DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Hrb87F and Rbfox3

DIOPT Version :9

Sequence 1:	NP_001163602.1	Gene:	Hrb87F / 48535	FlyBaseID:	FBgn0004237	Length:	385	Species:	Drosophila melanogaster
Sequence 2:	NP_001034256.1	Gene:	Rbfox3 / 52897	MGIID:	106368	Length:	374	Species:	Mus musculus

Alignment Length:	97	Identity:	30/97 - (30%)
Similarity:	53/97 - (54%)	Gaps:	12/97 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly    18 TEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQ 82
            ||.:|.::|.:..:.:|..|..|:..|.::|.|:||.::.:  .:.|:||||:|:..|...|.|:
Mouse    93 TEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFN--ERGSKGFGFVTFETSSDADRAR 155

  Fly    83 NARPHKIDGRTVEPKRAVPRQEIDSPNAGATV 114
                .|::|..||.::      |:..||.|.|
Mouse   156 ----EKLNGTIVEGRK------IEVNNATARV 177

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Hrb87F	NP_001163602.1	RRM1_hnRNPA_like	25..102	CDD:241022	22/76 (29%)
Hrb87F	NP_001163602.1	RRM_SF	116..188	CDD:302621
Rbfox3	NP_001034256.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..105		4/11 (36%)
		ELAV_HUD_SF	<25..170	CDD:273741	26/88 (30%)
		RRM_FOX1_like	99..174	CDD:240853	24/86 (28%)
		Fox-1_C	208..345	CDD:372095
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910