DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and Rbm34

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_766350.2 Gene:Rbm34 / 52202 MGIID:1098653 Length:442 Species:Mus musculus


Alignment Length:251 Identity:54/251 - (21%)
Similarity:92/251 - (36%) Gaps:77/251 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QNDSNGNYDDGEEI-------------------TEPEQL---RKLFIGGLDYRTTDDGLKAHFEK 46
            ::.|.|...|||.:                   .|.|:|   |.:|:|.|........||:.|::
Mouse   147 RSQSRGKVADGEALDVALSLAKDGGQRTKIPVNPEEERLKNERTVFVGNLPVTCNKKKLKSFFKE 211

  Fly    47 WGNIVDV---------------------------------VVMKDPKTKRSRGFGFITYSQSYMI 78
            :|.:..|                                 ||.||....          :::...
Mouse   212 YGQVESVRFRSVMPAEGTLTKKLAAIKRKFHPDQKSINAYVVFKDESAA----------AKALQR 266

  Fly    79 DNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVS 143
            :.||.|...:|            |.::.|..|....:.:|||.|....::..|.|:|.|.|.||:
Mouse   267 NGAQIAEGFRI------------RVDLASETASRDKRSVFVGNLPYKIEDSALEEHFLDCGSIVA 319

  Fly   144 VNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMDRQ 199
            |.||.:..||..|||.::.|::.|.|...:......:..:.|.|.:::.|:.:.:|
Mouse   320 VRIVRNPLTGVGRGFGYVLFENTDAVHLALKLNNSELMGRKLRVMRSVNKEKLKQQ 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 16/109 (15%)
RRM_SF 116..188 CDD:302621 23/71 (32%)
Rbm34NP_766350.2 RRM1_RBM34 189..280 CDD:240840 18/112 (16%)
RRM2_RBM34 292..364 CDD:240841 23/71 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.