DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and Hnrnpdl

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_057899.2 Gene:Hnrnpdl / 50926 MGIID:1355299 Length:420 Species:Mus musculus


Alignment Length:322 Identity:110/322 - (34%)
Similarity:158/322 - (49%) Gaps:47/322 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NDSNGNYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGF 69
            |.|....|||          |:|||||.:.|:...|..:..::|.:||..:..||.|.|||||||
Mouse   139 NASKNQQDDG----------KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGF 193

  Fly    70 ITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREY 134
            :.:..:..:|.....:.||:||:.::||||...:..:.|      ||:|||||..|..||.::||
Mouse   194 VLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPP------KKVFVGGLSPDTSEEQIKEY 252

  Fly   135 FKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVK----KAIAKQD 195
            |..||:|.::.:..|..|.::|||.||.:.|.:||.|::..:.|.|.:...::|    |.:.:|.
Mouse   253 FGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQ 317

  Fly   196 MDRQGGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQG- 259
            ..:|.||.|..   ||||||...||:|    .|||...|..|:...    |:||....:||.|. 
Mouse   318 QQQQKGGRGAA---AGGRGGARGRGRG----QGQNWNQGFNNYYDQ----GYGNYNSAYGGDQNY 371

  Fly   260 GGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQ 321
            .|.||::..|.:.|             |.|.|.||  .:.:|.....|....|||...|.||
Mouse   372 SGYGGYDYTGYNYG-------------NYGYGQGY--ADYSGQQSTYGKASRGGGNHQNNYQ 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 30/76 (39%)
RRM_SF 116..188 CDD:302621 28/71 (39%)
HnrnpdlNP_057899.2 RRM1_hnRPDL 149..224 CDD:241202 29/74 (39%)
RRM2_hnRPDL 234..308 CDD:241029 29/73 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.