DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and msi1

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_012816886.1 Gene:msi1 / 496961 XenbaseID:XB-GENE-490596 Length:347 Species:Xenopus tropicalis


Alignment Length:181 Identity:71/181 - (39%)
Similarity:110/181 - (60%) Gaps:2/181 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKI 89
            |:|||||.::||.:||:.:|..:|::.:.:||:||.|||||||||:|:.....:|.......|::
 Frog    21 KMFIGGLSWQTTQEGLREYFSHFGDVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHEL 85

  Fly    90 DGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGK 154
            |.:|::||.|.||:.  .|......||:|||||..:...|.:::||:.||::....::.||.|.:
 Frog    86 DSKTIDPKVAFPRRA--QPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNR 148

  Fly   155 KRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMDRQGGGGGR 205
            .|||.|:.|:..|.|:|:.....|.|.||.::.|||..|:.|...|...||
 Frog   149 HRGFGFVTFEGEDIVEKVCDIHFHEINNKMVECKKAQPKEVMSPTGSVRGR 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 33/76 (43%)
RRM_SF 116..188 CDD:302621 26/71 (37%)
msi1XP_012816886.1 RRM1_MSI1 20..96 CDD:241203 32/74 (43%)
PABP-1234 <32..324 CDD:130689 64/170 (38%)
RRM2_MSI 110..183 CDD:240769 26/72 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.