DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and RBMXL1

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001156008.1 Gene:RBMXL1 / 494115 HGNCID:25073 Length:390 Species:Homo sapiens


Alignment Length:414 Identity:94/414 - (22%)
Similarity:135/414 - (32%) Gaps:158/414 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 EIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDP 168
            |.|.|.      |||:|||..:.:|:.|...|..:|:||.|.::.|::|.|.|||||:.|:  .|
Human     3 EADRPG------KLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFE--SP 59

  Fly   169 VDKIILQKTHSIKNKTLDVKKAIAKQDMDRQGGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQN 233
            .|  .......:..|:|| .|||..:...:.....||.||....|.....||.|.|.        
Human    60 AD--AKDAARDMNGKSLD-GKAIKVEQATKPSFERGRHGPPPPPRSRGPPRGFGAGR-------- 113

  Fly   234 GGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSG------------GGPWNNQGGGNG-- 284
                 ||:||..|..:.||:.  ..||.|..:|.....|            |||...:...:|  
Human   114 -----GGSGGTRGPPSRGGHM--DDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPSPKRSAPSGLV 171

  Fly   285 -GWNGGGG-----------GG-------------------------------------------- 293
             ..:|.||           ||                                            
Human   172 RSSSGMGGRAPLSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAP 236

  Fly   294 ---------YGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGGGPQRNS--NFGNNRPAPYSQG-- 345
                     ||..:|...:...|.|...|.|...:|.....||..|:|  ::||:|.||.::|  
Human   237 PPRDYTYRDYGHSSSRDDYPSRGYGDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPLTRGPP 301

  Fly   346 ---GGGGGFNK-GNQGGGQGFAGNNYNT------------------------------------- 369
               ||...::. .:...|.|.:.::|::                                     
Human   302 PSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSCDRVGRQERGLPPSVERGYPSSRDSYSSS 366

  Fly   370 --------GGGGQGGNMGGGNRRY 385
                    |.||...:.|||..||
Human   367 SRGAPRGAGPGGSRSDRGGGRSRY 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022
RRM_SF 116..188 CDD:302621 27/71 (38%)
RBMXL1NP_001156008.1 RRM_RBMX_like 7..86 CDD:240828 31/89 (35%)
RRM <9..>85 CDD:223796 30/80 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 62..390 65/343 (19%)
RBM1CTR 173..217 CDD:285341 5/43 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.