DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and CCDC88C

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001073883.2 Gene:CCDC88C / 440193 HGNCID:19967 Length:2028 Species:Homo sapiens


Alignment Length:171 Identity:30/171 - (17%)
Similarity:61/171 - (35%) Gaps:31/171 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EKWGNIVDVVVMKDPKTKR-------SRGFGFITYSQSYMIDNAQNA--------RPHK-IDGRT 93
            |:.|.:...|...:..|::       |:|......:....:|..||.        |.:| :|...
Human   642 EENGRLARKVTSLETATEKVEALEHESQGLQLENRTLRKSLDTLQNVSLQLEGLERDNKQLDAEN 706

  Fly    94 VEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGF 158
            :|.:|.|......|.......::    ..:.:.::|.||:           |:...|..|||...
Human   707 LELRRLVETMRFTSTKLAQMERE----NQQLEREKEELRK-----------NVDLLKALGKKSER 756

  Fly   159 AFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMDRQ 199
            ..:.:......:..:.|...|..:||..::..:.:.:.:||
Human   757 LELSYQSVSAENLRLQQSLESSSHKTQTLESELGELEAERQ 797

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 15/72 (21%)
RRM_SF 116..188 CDD:302621 12/71 (17%)
CCDC88CNP_001073883.2 HOOK 17..633 CDD:283312
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..250
Myosin_tail_1 329..1319 CDD:279860 30/171 (18%)
RILP-like <489..601 CDD:304877
DUF2570 664..>741 CDD:305162 13/80 (16%)
RILP-like <755..868 CDD:304877 6/43 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1011..1043
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1419..1724
GBA. /evidence=ECO:0000269|PubMed:30194280 1661..1691
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1736..1803
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1816..2021
PDZ-binding. /evidence=ECO:0000255 2025..2028
DVL1-binding. /evidence=ECO:0000250|UniProtKB:Q6VGS5 2026..2028
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.