DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and rbm34

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001002382.1 Gene:rbm34 / 436655 ZFINID:ZDB-GENE-040718-77 Length:411 Species:Danio rerio


Alignment Length:250 Identity:58/250 - (23%)
Similarity:103/250 - (41%) Gaps:45/250 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SNGNYDDGEEITE---------PEQL---RKLFIGGLDYRTTDDGLKAHFEKWGNIVDV----VV 55
            ::|..|:.|..|:         .|:|   |.:|:|.|........|.:.|:|.|.|..|    |:
Zfish   120 ADGGEDEEERPTKHKKTVKFNAEERLKMKRTVFVGNLPSSCKKKDLLSVFKKSGVIESVRFRSVI 184

  Fly    56 MKDP-------------KTKRSRGFGFITYSQSYMIDNAQNARPHKID-GRTVEPKRAVPRQEID 106
            .:||             ..|:.....:|.:.:.....:|.....|:|. |..:...|.....:.|
Zfish   185 REDPTMSRKVAAIQRKVHPKKQNINAYIVFKEEESATDALKWNGHEIQAGFYIRVDRVSQHSKHD 249

  Fly   107 SPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDK 171
            ..      :.:|||.|..|..|..|:.:|::.|.|.:|.:|.|:|:|..:||.::.|:..|.|..
Zfish   250 HK------RSIFVGNLPYDISELPLQNHFQECGNIEAVRLVRDRDSGMGKGFGYVLFESPDSVML 308

  Fly   172 IILQKTHSIKNKTLDVKKAIAKQ---------DMDRQGGGGGRGGPRAGGRGGQG 217
            .:.....:::.:.:.||:::.|:         ..:.|..|||..||:...|...|
Zfish   309 ALKLNGSTLQQRKIRVKRSVKKEKEKKTPPGRKAEGQRTGGGLKGPKQEFRNNTG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 19/94 (20%)
RRM_SF 116..188 CDD:302621 20/71 (28%)
rbm34NP_001002382.1 RRM1_RBM34 149..240 CDD:240840 19/90 (21%)
RRM2_RBM34 253..325 CDD:240841 20/71 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.