DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and trv

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster


Alignment Length:209 Identity:49/209 - (23%)
Similarity:88/209 - (42%) Gaps:34/209 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DDGEEITEPEQLRK---LFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYS 73
            |..||:.....|.|   :|:|.|........|:..|..:|.|.|..|::||:|.:|:|:||:::.
  Fly   297 DSDEEMEYMPPLHKQFHIFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFI 361

  Fly    74 QSYMIDNAQNARPHK-IDGRTVEPKRAVPRQEIDSPNAGATVKKL----------------FVGG 121
            :....::|..|...: :..|::....|..:    .|.:...:|.|                :|||
  Fly   362 KKSEAESAITAMNGQWLGSRSIRTNWATRK----PPASKENIKPLTFDEVYNQSSPSNCTVYVGG 422

  Fly   122 LRD---DHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNK 183
            :..   ...||.|::.|..:|.|..:.:..||      |:||:.|...:.....|: ..|:.:..
  Fly   423 VNSALTALSEEVLQKTFAPYGAIQEIRVFKDK------GYAFVRFSTKEAATHAIV-GVHNTEIN 480

  Fly   184 TLDVKKAIAKQDMD 197
            ...||.:..|:..|
  Fly   481 AQPVKCSWGKESGD 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 21/80 (26%)
RRM_SF 116..188 CDD:302621 18/90 (20%)
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 19/73 (26%)
RRM3_TIA1_like 416..491 CDD:240800 19/81 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.