DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and msi

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001247303.1 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster


Alignment Length:170 Identity:67/170 - (39%)
Similarity:105/170 - (61%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKI 89
            |||:|||.::|:.|.||.:|..:|.:.||::||||.|:|||||||||:.:...::.......|.:
  Fly   204 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTL 268

  Fly    90 DGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGK 154
            ||:.::||.|.|:   :.|......||:||||:..|...|.::.||..||.:....::.|:.|.:
  Fly   269 DGKKIDPKHATPK---NRPRQANKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKR 330

  Fly   155 KRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQ 194
            .|||.|:.|::.|.||::.....|:||||.::.|||..|:
  Fly   331 HRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKE 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 34/76 (45%)
RRM_SF 116..188 CDD:302621 26/71 (37%)
msiNP_001247303.1 RRM1_hnRNPA_hnRNPD_like 205..276 CDD:240771 30/70 (43%)
RRM2_MSI 292..365 CDD:240769 26/72 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463949
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.