DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and CG5213

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster


Alignment Length:201 Identity:54/201 - (26%)
Similarity:78/201 - (38%) Gaps:41/201 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GNYDDGEEITEPEQL------RKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGF 67
            |.:..|..:..|..|      ..|.:..|....|:..|...|.|:|.|....:::..:|..|..:
  Fly    20 GMFQTGRPVDPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCY 84

  Fly    68 GFITYSQSYMIDNAQNARPHKIDGRTVEPKR-----AVPRQEIDSPNAGATVKKLFVGGLRDDHD 127
            ||:.|........|.|.    :||.....||     |.| .|.:|     |...|:||.|....|
  Fly    85 GFVDYVSERQAAAAVNG----MDGYETRGKRLKVAFARP-SEYES-----TSSSLYVGNLPTYMD 139

  Fly   128 EECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIA 192
            |:.:||.|..:|.||.||::..|...:.||.||::|:                    |.....:|
  Fly   140 EKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFE--------------------LVRDAEVA 184

  Fly   193 KQDMDR 198
            |..|||
  Fly   185 KYGMDR 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 20/81 (25%)
RRM_SF 116..188 CDD:302621 21/71 (30%)
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 19/79 (24%)
RRM 128..202 CDD:214636 26/83 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.