DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and Rbp4

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster


Alignment Length:188 Identity:75/188 - (39%)
Similarity:113/188 - (60%) Gaps:13/188 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNAR 85
            |.|||:|||||..:||.:.|:..|.::|.:.|.||::||.:..||||||:||.....::..|.||
  Fly    29 EHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRAR 93

  Fly    86 PHKIDGRTVEPKRAVPRQEID-SPNAGATV------------KKLFVGGLRDDHDEECLREYFKD 137
            ||.||.:.||.|.|:|||:.. ....|:.|            |::|:|||::.|||..:||||..
  Fly    94 PHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQ 158

  Fly   138 FGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQD 195
            ||.:.||.::.|::||::|.|.|:||.|....:|.:..:.|.|....::||::..|.|
  Fly   159 FGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKAD 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 35/76 (46%)
RRM_SF 116..188 CDD:302621 27/71 (38%)
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 35/76 (46%)
RRM2_hnRNPA_like 137..209 CDD:240774 27/71 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463972
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA81
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.