DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and rbfox1l

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_999940.1 Gene:rbfox1l / 407613 ZFINID:ZDB-GENE-040923-2 Length:382 Species:Danio rerio


Alignment Length:110 Identity:28/110 - (25%)
Similarity:58/110 - (52%) Gaps:13/110 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SNGNYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFIT 71
            :.|:.::|....:|   ::|.:..:.:|..|..|:..|.::|.|:||.::.:  .:.|:||||:|
Zfish   133 AGGSDEEGGGKAQP---KRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFN--ERGSKGFGFVT 192

  Fly    72 YSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKK 116
            :..:...|.|:    .|::|..||.::.    |:::..|....||
Zfish   193 FESAVEADRAR----EKLNGTIVEGRKI----EVNNATARVVTKK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 21/76 (28%)
RRM_SF 116..188 CDD:302621 1/1 (100%)
rbfox1lNP_999940.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..79
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..148 3/17 (18%)
RRM <143..>237 CDD:223796 26/100 (26%)
RRM_FOX1_like 147..222 CDD:240853 22/84 (26%)
Fox-1_C 257..353 CDD:289199
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.