DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and CG2931

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster


Alignment Length:159 Identity:41/159 - (25%)
Similarity:64/159 - (40%) Gaps:45/159 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 AQNARPHKIDGRTVEPKRA---------VPRQEIDSPN---AGATV-------------KKLFVG 120
            |:.:.|:.|....::..||         ..|::.|...   ||.||             .::|.|
  Fly   139 AEKSGPNPIAEEAIKAARASSALQSFQTTERKKKDRKTVRIAGGTVWEDTSLADWPDDDFRIFCG 203

  Fly   121 GLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQK--------T 177
            .|.:|.::|.|...|..|.......:|.||.|||.:||.|:.|  .:|.|.|...|        :
  Fly   204 DLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSF--REPADFIRAMKEMDGRYVGS 266

  Fly   178 HSIK-------NKTLDVKKAIAKQDMDRQ 199
            ..||       .::|||.|   |::.::|
  Fly   267 RPIKLRKSTWRQRSLDVVK---KKEREKQ 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 5/29 (17%)
RRM_SF 116..188 CDD:302621 26/86 (30%)
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:240829 24/83 (29%)
RRM <194..>280 CDD:223796 24/87 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463978
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.