DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and Rbp6

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster


Alignment Length:224 Identity:81/224 - (36%)
Similarity:117/224 - (52%) Gaps:10/224 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNA 84
            |....|:|||||.::|:.:.|:.:|.::|:|.:.:|||||.|:|||||||:|:|....:|.....
  Fly    25 PNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQ 89

  Fly    85 RPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSD 149
            ..|::||:.|:||.|.||:.  .|......||:|||||......|.::.||:.||.|....::.|
  Fly    90 GTHELDGKKVDPKVAFPRRA--HPKMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFD 152

  Fly   150 KDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMDRQGGGGGRGGPRAGGRG 214
            |.|.:.|||.|:.|...|.|||:.....|.|.||.::.|||..|:.|    ........||.||.
  Fly   153 KQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEVM----LPANLAKTRAAGRS 213

  Fly   215 GQGDRGQGGGGWGGQNRQNGGGNWGGAGG 243
            ..|:...    ||..:..:.......|.|
  Fly   214 AYGELVV----WGSSHAHSTAATSAAAAG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 34/76 (45%)
RRM_SF 116..188 CDD:302621 28/71 (39%)
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 32/73 (44%)
RRM2_MSI 119..192 CDD:240769 28/72 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463948
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I1542
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.