DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and sf3b4

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_989116.1 Gene:sf3b4 / 394721 XenbaseID:XB-GENE-492933 Length:388 Species:Xenopus tropicalis


Alignment Length:193 Identity:54/193 - (27%)
Similarity:92/193 - (47%) Gaps:9/193 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNA 81
            |:|..|...:::||||.:.::..|...|.:.|.:|:..:.||..|.:.:|:||:.:......|.|
 Frog     6 ISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYA 70

  Fly    82 -QNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSV- 144
             :.....|:.|:.:...:|....:  :.:.||.:   |:|.|..:.||:.|.:.|..||.|:.. 
 Frog    71 IKIMNMIKLYGKPIRVNKASAHNK--NLDVGANI---FIGNLDPEIDEKLLYDTFSAFGVILQTP 130

  Fly   145 NIVSDKDTGKKRGFAFIEFDDYDPVDKII-LQKTHSIKNKTLDVKKAIAKQDM-DRQGGGGGR 205
            .|:.|.|||..:|:|||.|..:|..|..| ......:.|:.:.|..|..|... :|.|....|
 Frog   131 KIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAER 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 19/77 (25%)
RRM_SF 116..188 CDD:302621 24/73 (33%)
sf3b4NP_989116.1 RRM1_SF3B4 15..88 CDD:240780 18/72 (25%)
RRM2_SF3B4 99..181 CDD:240781 28/84 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.