DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and rbm24

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_989016.1 Gene:rbm24 / 394612 XenbaseID:XB-GENE-493647 Length:226 Species:Xenopus tropicalis


Alignment Length:73 Identity:33/73 - (45%)
Similarity:45/73 - (61%) Gaps:10/73 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHK- 88
            |:|:|||.|.|||..|:.:||.:|:|.:.||:.|.:|.:|||:||:|     |.|.|...|..| 
 Frog    12 KIFVGGLPYHTTDSSLRKYFEVFGDIEEAVVITDRQTGKSRGYGFVT-----MADRAAAERACKD 71

  Fly    89 ----IDGR 92
                ||||
 Frog    72 PNPIIDGR 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 33/73 (45%)
RRM_SF 116..188 CDD:302621
rbm24NP_989016.1 RRM_RBM24_RBM38_like 11..86 CDD:240830 33/73 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.