DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and rbm28

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_956615.1 Gene:rbm28 / 393291 ZFINID:ZDB-GENE-040426-960 Length:864 Species:Danio rerio


Alignment Length:217 Identity:56/217 - (25%)
Similarity:96/217 - (44%) Gaps:28/217 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EQNDSNGNYDDGEEITEPEQLRK---LFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRS 64
            |::..:|...:.|:|..|.:.::   |.|..|.::..||.||..|.|:|.:::..:...|..|: 
Zfish   100 EESQKSGETKNTEKIPSPTKKKENSWLIIRNLSFKCEDDELKQIFSKFGTVLETRIPLKPDGKK- 163

  Fly    65 RGFGFITY--------SQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATV------- 114
            :||.|:.:        :::.|...|...||.::|..|...:.|.|....:...|..|.       
Zfish   164 KGFAFVQFKCVSEAEKARAAMNRKAIRDRPVEVDWTTSNTESADPEDTEEPHKAEETTSTEKFKG 228

  Fly   115 -------KKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDK- 171
                   .:|.:..|....:|:.|::.|.:||.::...|....| ||||||||:.|.......| 
Zfish   229 IRKIKLKSRLIIRNLSFKCEEDDLKQIFSEFGTVLEAKIPLKPD-GKKRGFAFVLFKRMPEAGKA 292

  Fly   172 IILQKTHSIKNKTLDVKKAIAK 193
            :.......||::.:.|..||||
Zfish   293 LTAMNGKKIKDRQVAVDWAIAK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 22/87 (25%)
RRM_SF 116..188 CDD:302621 21/72 (29%)
rbm28NP_956615.1 ELAV_HUD_SF 2..316 CDD:273741 56/217 (26%)
RRM1_RBM28_like 5..77 CDD:240859
RRM2_RBM28_like 126..198 CDD:240860 19/72 (26%)
RRM2_RBM28_like 237..312 CDD:240860 22/75 (29%)
RRM3_RBM28_like 438..520 CDD:240861
RRM4_RBM28_like 590..683 CDD:240862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.