DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and CG3335

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster


Alignment Length:180 Identity:52/180 - (28%)
Similarity:91/180 - (50%) Gaps:21/180 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AEQNDSNGNYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNI--VDVVVMKDPKTKR- 63
            |:.::.:...:|.::  |||....||:..|:::|..:.::.||...|:|  |::...:||:..| 
  Fly   659 AKPDEEDSRAEDADD--EPEPNTTLFLRNLNFKTVQETVEKHFRHLGSIHTVEIAKRRDPENPRE 721

  Fly    64 --SRGFGFITYSQSYMIDNA-QNARPHKIDGRTVEPKRAVPRQEIDSPNAGA----------TVK 115
              |.|:|||.:.:|.:.::| :|.:...|||..||.||: .|......|.||          |..
  Fly   722 FKSLGYGFIQFKKSSVAEHALKNLQLTHIDGNPVELKRS-DRVLKTQDNDGAQRRLASQKKQTGT 785

  Fly   116 KLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGK--KRGFAFIEF 163
            |:.|..:........:|:.||.||::.|:.|.....||:  .|||.|:::
  Fly   786 KILVRNIPFQAQYREVRDIFKAFGELRSLRIPKKATTGEDAHRGFGFVDY 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 27/82 (33%)
RRM_SF 116..188 CDD:302621 15/50 (30%)
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011
RRM4_RBM19 552..623 CDD:241013
RRM <638..845 CDD:223796 52/180 (29%)
RRM5_RBM19_like 679..760 CDD:240764 26/80 (33%)
RRM6_RBM19 785..864 CDD:241015 15/51 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463966
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.