DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and LS2

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_611769.2 Gene:LS2 / 37681 FlyBaseID:FBgn0034834 Length:449 Species:Drosophila melanogaster


Alignment Length:201 Identity:48/201 - (23%)
Similarity:80/201 - (39%) Gaps:58/201 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QLRKLFIGGLDYRTTDDGLKAHFE----------KWGNIVDVVVMKDPKTKRSRGFGFITYSQSY 76
            |.|:|::|.:.:..||:.:...|.          |..:.:|...:...:|...:.|.|:.:..  
  Fly   109 QARRLYVGNIPFGVTDEEMMQFFNHQIMALGFEAKSSHYMDGNAVLTCQTNLEKNFAFLEFRS-- 171

  Fly    77 MIDNAQNA----------------RPH------KIDGRTVEPKRA--VPRQEI------------ 105
             ||.|..|                |||      .|....:|..|:  ||...:            
  Fly   172 -IDEASQALNFDGMVFRGQTLKIRRPHDYQPVPSISVSAMESYRSFRVPAINVAQQPAVTLPVTT 235

  Fly   106 ---DSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYD 167
               ||||      |::||||....:::.::|..:.||::..:|:|.|.:|...:||||.|:.|..
  Fly   236 IVPDSPN------KIYVGGLPTCLNQDQVKELLQSFGELKGLNLVMDTNTNLNKGFAFFEYCDPS 294

  Fly   168 PVDKII 173
            ..|..|
  Fly   295 VTDHAI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 21/110 (19%)
RRM_SF 116..188 CDD:302621 20/58 (34%)
LS2NP_611769.2 RRM1_U2AF65 110..196 CDD:240676 15/88 (17%)
RRM2_U2AF65 242..318 CDD:240677 21/65 (32%)
RRM3_U2AF65 349..436 CDD:240678
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.