Sequence 1: | NP_001163602.1 | Gene: | Hrb87F / 48535 | FlyBaseID: | FBgn0004237 | Length: | 385 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_611769.2 | Gene: | LS2 / 37681 | FlyBaseID: | FBgn0034834 | Length: | 449 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 48/201 - (23%) |
---|---|---|---|
Similarity: | 80/201 - (39%) | Gaps: | 58/201 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 QLRKLFIGGLDYRTTDDGLKAHFE----------KWGNIVDVVVMKDPKTKRSRGFGFITYSQSY 76
Fly 77 MIDNAQNA----------------RPH------KIDGRTVEPKRA--VPRQEI------------ 105
Fly 106 ---DSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYD 167
Fly 168 PVDKII 173 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hrb87F | NP_001163602.1 | RRM1_hnRNPA_like | 25..102 | CDD:241022 | 21/110 (19%) |
RRM_SF | 116..188 | CDD:302621 | 20/58 (34%) | ||
LS2 | NP_611769.2 | RRM1_U2AF65 | 110..196 | CDD:240676 | 15/88 (17%) |
RRM2_U2AF65 | 242..318 | CDD:240677 | 21/65 (32%) | ||
RRM3_U2AF65 | 349..436 | CDD:240678 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |