DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and bru1

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001260403.1 Gene:bru1 / 34648 FlyBaseID:FBgn0000114 Length:810 Species:Drosophila melanogaster


Alignment Length:159 Identity:43/159 - (27%)
Similarity:82/159 - (51%) Gaps:8/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DSNGNYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFI 70
            |::.....||:..:|:.: |:|:|.:.....:..|:..||::|.:..:.|::|..|..|:|..|:
  Fly   340 DTDATVTYGEKEPDPDNI-KMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFV 403

  Fly    71 TYSQSYMIDNAQNARPHKIDGRTVEPK-RAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREY 134
            |:...:....||:|. |.:  :|:... ..:..:..||.|...  :|||||.|....:|..:|:.
  Fly   404 TFYTRHAALKAQDAL-HNV--KTLNGMYHPIQMKPADSENRNE--RKLFVGMLNKKLNENDVRKL 463

  Fly   135 FKDFGQIVSVNIVSDKDTGKKRGFAFIEF 163
            |:..|.|....::.|:: |:.:|.||:.|
  Fly   464 FEVHGAIEECTVLRDQN-GQSKGCAFVTF 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 19/77 (25%)
RRM_SF 116..188 CDD:302621 17/48 (35%)
bru1NP_001260403.1 RRM1_CELF1_2_Bruno 356..437 CDD:241075 19/84 (23%)
ELAV_HUD_SF 359..808 CDD:273741 38/139 (27%)
RRM2_Bruno_like 443..524 CDD:241080 17/52 (33%)
RRM3_Bruno_like 722..800 CDD:241084
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.