DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and Caper

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster


Alignment Length:221 Identity:55/221 - (24%)
Similarity:94/221 - (42%) Gaps:28/221 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DGEEITEPEQL-------RKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFI 70
            :|.:.|.|.:|       |.:|...|..|.....|:..|...|.:.||.::...||||.:|..:|
  Fly   219 NGADRTTPTELSPEERDARTVFCIQLSQRVRARDLEEFFSSVGKVRDVRLITCNKTKRFKGIAYI 283

  Fly    71 TYSQSYMIDNAQNARPHKIDGRTV-------EPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDE 128
            .:.....:..|......::.|..:       |..|.........|.:.....:|:||.|..:..|
  Fly   284 EFDDPESVALALGLSGQRLLGVPIMVQHTQAEKNRLQNAAPAFQPKSHTGPMRLYVGSLHFNITE 348

  Fly   129 ECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQ--------KTHSIKNKT- 184
            :.||..|:.||:|.::.::.|.:||:.:|:.||.:.:.|...|.:.|        :...:.|.| 
  Fly   349 DMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLNGFELAGRLMKVGNVTE 413

  Fly   185 -LDVK-KAIAKQDMDRQG---GGGGR 205
             ||:. .::...:|||.|   |..||
  Fly   414 RLDMNTTSLDTDEMDRTGIDLGATGR 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 18/83 (22%)
RRM_SF 116..188 CDD:302621 24/81 (30%)
CaperNP_609095.1 RRM1_RBM39_like 238..310 CDD:240729 16/71 (23%)
RRM2_RBM23_RBM39 337..409 CDD:240730 20/71 (28%)
RBM39linker 425..500 CDD:292157 7/15 (47%)
RRM3_RBM39_like 483..567 CDD:240731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463934
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.