DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and Secp43

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster


Alignment Length:237 Identity:54/237 - (22%)
Similarity:94/237 - (39%) Gaps:35/237 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KLFIGGLDYRTTDDGLKAHFEKWG-NIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHK 88
            :|::|.|:...|::.:.|.|.|.| :...|.:|::..|....|:.|:.:...   |:|.:|. ||
  Fly     7 QLWMGSLESYMTENFIIAAFRKMGEDPTTVRLMRNKYTGEPAGYCFVNFISD---DHALDAM-HK 67

  Fly    89 IDGRTVEPKRAVPRQEIDSPNAGATVK--------KLFVGGLRDDHDEECLREYFKD-FGQIVSV 144
            ::|:.:.....:.|..::|  |..:.|        .::||.|..|.|:..|.:.|.. |..|.:.
  Fly    68 LNGKPIPGTNPIVRFRLNS--ASNSYKLPGNEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTA 130

  Fly   145 NIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTH--SIKNKTLDVKKAIAKQDMDRQGGGGGRGG 207
            .::.| ..|..:|:.|:.|...|.....:.....  .:..|.:.:..|:.|...: .||..|.|.
  Fly   131 KVILD-SLGFSKGYGFVRFGIEDEQKSALYDMNGYIGLGTKPIKICNAVPKPKSE-LGGAVGEGN 193

  Fly   208 PRAGGRGGQGDRG---------------QGGGGWGGQNRQNG 234
            ...|...|....|               ||...|.|...|.|
  Fly   194 TNYGYGSGMTAAGGTDYSQYYDPTSTYWQGYQAWQGYYEQAG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 19/77 (25%)
RRM_SF 116..188 CDD:302621 16/74 (22%)
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 22/88 (25%)
RRM2_SECp43 99..180 CDD:241056 17/81 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463920
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.