DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and SPAC25G10.01

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001342863.1 Gene:SPAC25G10.01 / 3361412 PomBaseID:SPAC25G10.01 Length:297 Species:Schizosaccharomyces pombe


Alignment Length:162 Identity:45/162 - (27%)
Similarity:74/162 - (45%) Gaps:32/162 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EQNDSNGNYDDGEEITEPEQLRK----LFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKR 63
            :.|:.:...|..|..:.||....    ||:.|:..|..:|.|:..|.|:|.:..|.:|::|.||.
pombe    76 DPNNESTALDKKEPQSAPEGSENLGNDLFVSGIASRMQEDELQQIFSKFGTVTHVRIMREPVTKA 140

  Fly    64 SRGFGFITYS----QSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRD 124
            ||||||:::|    .:..|||..:   .:..||.:..::| .|....||..|.     ::|    
pombe   141 SRGFGFLSFSTVEEATSAIDNLNS---QEFYGRVLNVQKA-KRSRPHSPTPGK-----YMG---- 192

  Fly   125 DHDEECLREYFKDFGQIVSVNIVSDKDTGKKR 156
             :|.   |...:||..       ::||.|.:|
pombe   193 -YDR---RRNSRDFPS-------NNKDGGYRR 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 27/84 (32%)
RRM_SF 116..188 CDD:302621 9/41 (22%)
SPAC25G10.01NP_001342863.1 RRM 9..>225 CDD:223796 45/162 (28%)
RRM_RBMX_like 100..179 CDD:240828 27/82 (33%)
RRM 207..>283 CDD:330708 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.