DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and HNRNPAB

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_112556.2 Gene:HNRNPAB / 3182 HGNCID:5034 Length:332 Species:Homo sapiens


Alignment Length:338 Identity:114/338 - (33%)
Similarity:169/338 - (50%) Gaps:63/338 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NGNYDDGEEIT---EPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGF 69
            |.|..:|::|.   ..|...|:|:|||.:.|:...||.:|.|:|.:||..:..||.|.|||||||
Human    51 NQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGF 115

  Fly    70 ITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREY 134
            |.:..:..::...:.:.|::|||.::||:|:..::  .|     |||:|||||..:..||.:|||
Human   116 ILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKK--DP-----VKKIFVGGLNPEATEEKIREY 173

  Fly   135 FKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMDRQ 199
            |.:||:|.::.:..|....|:|||.||.|.:.:||.|::.:|.|::.....::|.|..|:...:|
Human   174 FGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQ 238

  Fly   200 GGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGG 264
                                ..|.||.|.:||    ||.|..|||||            ||.|..
Human   239 --------------------QYGSGGRGNRNR----GNRGSGGGGGG------------GGQSQS 267

  Fly   265 WNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQ---SYGG 326
            |||    |.|.:.|||   .|:..|.|.||||.:.:..       |..|.|.|.:|.|   :||.
Human   268 WNQ----GYGNYWNQG---YGYQQGYGPGYGGYDYSPY-------GYYGYGPGYDYSQGSTNYGK 318

  Fly   327 GPQRNSNFGNNRP 339
            ..:|..:..|.:|
Human   319 SQRRGGHQNNYKP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 31/76 (41%)
RRM_SF 116..188 CDD:302621 28/71 (39%)
HNRNPABNP_112556.2 CBFNT 1..70 CDD:311868 5/18 (28%)
RRM1_hnRNPAB 66..145 CDD:410151 31/78 (40%)
RRM2_hnRNPAB 150..229 CDD:409997 32/85 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.