Sequence 1: | NP_001163602.1 | Gene: | Hrb87F / 48535 | FlyBaseID: | FBgn0004237 | Length: | 385 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014037.1 | Gene: | Rbm34 / 307956 | RGDID: | 1310161 | Length: | 428 | Species: | Rattus norvegicus |
Alignment Length: | 251 | Identity: | 55/251 - (21%) |
---|---|---|---|
Similarity: | 93/251 - (37%) | Gaps: | 77/251 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 QNDSNGNYDDGEEI-------------------TEPEQL---RKLFIGGLDYRTTDDGLKAHFEK 46
Fly 47 WGNIVDV---------------------------------VVMKDPKTKRSRGFGFITYSQSYMI 78
Fly 79 DNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVS 143
Fly 144 VNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMDRQ 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hrb87F | NP_001163602.1 | RRM1_hnRNPA_like | 25..102 | CDD:241022 | 15/109 (14%) |
RRM_SF | 116..188 | CDD:302621 | 25/71 (35%) | ||
Rbm34 | NP_001014037.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..106 | ||
RRM | 73..364 | CDD:223796 | 53/244 (22%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 127..152 | 3/10 (30%) | |||
RRM1_RBM34 | 183..274 | CDD:240840 | 17/112 (15%) | ||
RRM2_RBM34 | 286..358 | CDD:240841 | 25/71 (35%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 361..428 | 2/9 (22%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |