DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and Rbm34

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001014037.1 Gene:Rbm34 / 307956 RGDID:1310161 Length:428 Species:Rattus norvegicus


Alignment Length:251 Identity:55/251 - (21%)
Similarity:93/251 - (37%) Gaps:77/251 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QNDSNGNYDDGEEI-------------------TEPEQL---RKLFIGGLDYRTTDDGLKAHFEK 46
            ::.|.|...|||.:                   .|.|:|   |.:|:|.|........||:.|::
  Rat   141 RSQSRGKVTDGEALDVALSLNEDGRQRTKVPLNPEEERLKNERTVFVGNLPVTCNKKKLKSFFKE 205

  Fly    47 WGNIVDV---------------------------------VVMKDPKTKRSRGFGFITYSQSYMI 78
            :|.:..|                                 ||.|:.:..          :::...
  Rat   206 YGQVESVRFRSVMPAEGTLSKKLAAIKRKFHPDQKSINAYVVFKEERAA----------AKALQR 260

  Fly    79 DNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVS 143
            :.||.|...:|            |.::.|..|....:.:|||.|....||..|.|:|.|.|.||:
  Rat   261 NGAQIAEGFRI------------RVDLASETASRDKRSVFVGNLPYRVDESALEEHFLDCGSIVA 313

  Fly   144 VNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMDRQ 199
            |.||.:..||..|||.::.|::.|.|...:......:..:.|.|.:::.|:.:.:|
  Rat   314 VRIVRNPLTGVGRGFGYVLFENTDAVHLALKLNNSELMGRKLRVMRSVNKEKLKQQ 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 15/109 (14%)
RRM_SF 116..188 CDD:302621 25/71 (35%)
Rbm34NP_001014037.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..106
RRM 73..364 CDD:223796 53/244 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..152 3/10 (30%)
RRM1_RBM34 183..274 CDD:240840 17/112 (15%)
RRM2_RBM34 286..358 CDD:240841 25/71 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..428 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.