DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and Pabpn1l

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001107251.1 Gene:Pabpn1l / 307920 RGDID:1562761 Length:269 Species:Rattus norvegicus


Alignment Length:168 Identity:39/168 - (23%)
Similarity:62/168 - (36%) Gaps:36/168 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PHKIDGRTVEPKRAVPRQEIDSP-------------NAGATVKKLFVGGLRDDHDEECLREYFKD 137
            |..:..:..|.:||..| |:.||             |..|..:.::||.:........|..||..
  Rat    98 PPSVQRKATEEERAEAR-ELLSPETIGCFFPGAPKENVEADHRSVYVGNVDYGGSAAELEAYFSP 161

  Fly   138 FGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQ-------D 195
            .|:|..|.|:.||.:|..:|:|:|||.....|...:.....:.:.:.:   |.:.|:       .
  Rat   162 CGEIHRVTILCDKFSGHPKGYAYIEFASKSSVQAAVRLDESTFRGRVI---KVLPKRTNFPGISS 223

  Fly   196 MDRQG------------GGGGRGGPRAGGRGGQGDRGQ 221
            .||.|            .|..:..||....|....||:
  Rat   224 TDRGGLRTHSSSRAAFLQGSLQRKPRLRPHGQSRGRGR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 4/15 (27%)
RRM_SF 116..188 CDD:302621 18/71 (25%)
Pabpn1lNP_001107251.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..54
RRM <129..>223 CDD:223796 22/96 (23%)
RRM_SF 140..216 CDD:302621 20/78 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..269 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.