DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and A1CF

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001185748.1 Gene:A1CF / 29974 HGNCID:24086 Length:602 Species:Homo sapiens


Alignment Length:168 Identity:49/168 - (29%)
Similarity:73/168 - (43%) Gaps:29/168 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GNYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYS 73
            |....|.:...||:..::|||.|.....:|.|....||.|.|.::.:|.| ....:||:.|:|:|
Human    49 GGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMD-FNGNNRGYAFVTFS 112

  Fly    74 QSYMIDNAQNARPHKIDGRTVEPKRAVPR---QEIDSPN-----AGATVKKLFVGGL-RDDHDEE 129
            ..                  ||.|.|:.:   .||.:..     |.....:|||||: :....||
Human   113 NK------------------VEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREE 159

  Fly   130 CLREYFKDFGQIVSVNIV-SDKDTGKKRGFAFIEFDDY 166
            .|.|..|....:|.|.:. |..|..|.|||||:|::.:
Human   160 ILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESH 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 21/76 (28%)
RRM_SF 116..188 CDD:302621 21/53 (40%)
A1CFNP_001185748.1 hnRNP-R-Q 29..602 CDD:273732 49/168 (29%)
RRM1_ACF 63..140 CDD:240930 23/95 (24%)
RRM2_ACF 142..226 CDD:240934 21/56 (38%)
RRM3_ACF 231..313 CDD:240942
DND1_DSRM 455..531 CDD:291380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.