DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and RBMX

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_002130.2 Gene:RBMX / 27316 HGNCID:9910 Length:391 Species:Homo sapiens


Alignment Length:413 Identity:97/413 - (23%)
Similarity:135/413 - (32%) Gaps:155/413 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 EIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDP 168
            |.|.|.      |||:|||..:.:|:.|...|..:|:||.|.::.|::|.|.|||||:.|:  .|
Human     3 EADRPG------KLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFE--SP 59

  Fly   169 VDKIILQKTHSIKNKTLDVKKAIAKQDMDRQGGGGGRGGP------RAGGRGGQGDRGQGGGGWG 227
            .|  .......:..|:|| .|||..:...:.....||.||      |...||.:|.||..||..|
Human    60 AD--AKDAARDMNGKSLD-GKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTRG 121

  Fly   228 GQNRQNGGGNWGGAGGGGGFGNSGG---NFGGGQGGG-----------SGGWNQQGGSGGGPWNN 278
            ..:|             ||..:.||   ||......|           |||...:..:..||..:
Human   122 PPSR-------------GGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRS 173

  Fly   279 QGGGNG------GWNGGGG---------------------------------------------- 291
            ..|..|      |.:..||                                              
Human   174 SSGMGGRAPVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPP 238

  Fly   292 -----GGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGGGPQRNS--NFGNNRPAPYSQGG--- 346
                 ..||..:|...:...|.....|.|...:|.....||..|:|  ::||:|.||.::|.   
Human   239 RDYTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGPPPS 303

  Fly   347 -GGGGFNKGNQGGGQGFAGNN----------YNTG------------------------------ 370
             ||............|:.|:.          |::|                              
Human   304 YGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSS 368

  Fly   371 -----GGGQGG---NMGGGNRRY 385
                 |||:||   :.|||..||
Human   369 RGAPRGGGRGGSRSDRGGGRSRY 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022
RRM_SF 116..188 CDD:302621 27/71 (38%)
RBMXNP_002130.2 RRM_RBMX_like 7..86 CDD:409816 31/89 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..391 69/345 (20%)
dnaA 165..>306 CDD:237605 24/140 (17%)
RBM1CTR 173..217 CDD:400429 5/43 (12%)
Necessary for the association to nascent RNAPII transcripts and nuclear localization 186..236 3/49 (6%)
Necessary for RNA-binding 333..391 10/57 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.