DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and PABPC1

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_002559.2 Gene:PABPC1 / 26986 HGNCID:8554 Length:636 Species:Homo sapiens


Alignment Length:189 Identity:50/189 - (26%)
Similarity:93/189 - (49%) Gaps:20/189 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LRK-----LFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNA- 81
            |||     :||..||....:..|...|..:|||:...|:.|  ...|:|:||:.:......:.| 
Human    93 LRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCD--ENGSKGYGFVHFETQEAAERAI 155

  Fly    82 QNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKK---LFVGGLRDDHDEECLREYFKDFGQIVS 143
            :......::.|.|...|...|:|.:: ..||..|:   :::....:|.|:|.|::.|..||..:|
Human   156 EKMNGMLLNDRKVFVGRFKSRKEREA-ELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALS 219

  Fly   144 VNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAI---AKQDMDRQ 199
            |.:::| ::||.:||.|:.|:.::...|.:    ..:..|.|:.|:..   |::.::||
Human   220 VKVMTD-ESGKSKGFGFVSFERHEDAQKAV----DEMNGKELNGKQIYVGRAQKKVERQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 20/82 (24%)
RRM_SF 116..188 CDD:302621 19/74 (26%)
PABPC1NP_002559.2 PABP-1234 11..615 CDD:130689 50/189 (26%)
CSDE1-binding 166..289 31/114 (27%)
(Microbial infection) Binding to HRSV M2-1 protein. /evidence=ECO:0000269|PubMed:31649314 541..636
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.