DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and Rbfox1

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_006522218.3 Gene:Rbfox1 / 268859 MGIID:1926224 Length:550 Species:Mus musculus


Alignment Length:109 Identity:32/109 - (29%)
Similarity:55/109 - (50%) Gaps:19/109 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DGEEITEP-------EQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFI 70
            ||:..|:|       .|.::|.:..:.:|..|..|:..|.::|.|:||.::.:  .:.|:||||:
Mouse   225 DGQPQTQPSENTESKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFN--ERGSKGFGFV 287

  Fly    71 TYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATV 114
            |:..|...|.|:    .|:.|..||.::      |:..||.|.|
Mouse   288 TFENSADADRAR----EKLHGTVVEGRK------IEVNNATARV 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 22/76 (29%)
RRM_SF 116..188 CDD:302621
Rbfox1XP_006522218.3 PRK03427 <131..>248 CDD:235124 6/22 (27%)
RRM_FOX1_like 243..318 CDD:240853 24/86 (28%)
Fox-1_C 379..468 CDD:372095
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.