DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and SPAC328.05

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_594207.3 Gene:SPAC328.05 / 2542567 PomBaseID:SPAC328.05 Length:464 Species:Schizosaccharomyces pombe


Alignment Length:223 Identity:47/223 - (21%)
Similarity:90/223 - (40%) Gaps:65/223 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EQNDSNGNYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGF 67
            |..:.:.:..:|::.|:.|  |::::|.|.|:.....||....:.||:::..::..| ...|:|.
pombe    58 EHTERDPHLGNGQKYTQQE--RRVYVGNLSYQVRWFELKEFMGQVGNVLNCEILNLP-NGLSKGC 119

  Fly    68 GFITYS--------------QSYM-------IDNAQNAR--------PHKIDGRTVEPKRAVPRQ 103
            ..|.||              |.:|       .|..||||        ....:|:..||.|     
pombe   120 AIIEYSTAEEARTAIKTLSNQKFMGRLVYIREDREQNARFGSSSVSPSASSNGKDSEPDR----- 179

  Fly   104 EIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDP 168
                        :||||.|..:...:.|::.|:..|.::..:|..::: |:.||...:       
pombe   180 ------------QLFVGNLPYNVRWQDLKDLFRQAGSVIRADIQMNQE-GRSRGIGIV------- 224

  Fly   169 VDKIILQKTHSIK--------NKTLDVK 188
            |...:.:..|:|:        .:||:|:
pombe   225 VMSSMKEAMHAIQMLHNTDFMGRTLEVR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 24/105 (23%)
RRM_SF 116..188 CDD:302621 17/79 (22%)
SPAC328.05NP_594207.3 RRM 71..387 CDD:223796 45/210 (21%)
RRM_SF 79..150 CDD:240668 15/71 (21%)
RRM3_hnRNPM_like 181..252 CDD:240833 17/78 (22%)
RRM_SF 312..385 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.