Sequence 1: | NP_001163602.1 | Gene: | Hrb87F / 48535 | FlyBaseID: | FBgn0004237 | Length: | 385 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_594207.3 | Gene: | SPAC328.05 / 2542567 | PomBaseID: | SPAC328.05 | Length: | 464 | Species: | Schizosaccharomyces pombe |
Alignment Length: | 223 | Identity: | 47/223 - (21%) |
---|---|---|---|
Similarity: | 90/223 - (40%) | Gaps: | 65/223 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 EQNDSNGNYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGF 67
Fly 68 GFITYS--------------QSYM-------IDNAQNAR--------PHKIDGRTVEPKRAVPRQ 103
Fly 104 EIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDP 168
Fly 169 VDKIILQKTHSIK--------NKTLDVK 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hrb87F | NP_001163602.1 | RRM1_hnRNPA_like | 25..102 | CDD:241022 | 24/105 (23%) |
RRM_SF | 116..188 | CDD:302621 | 17/79 (22%) | ||
SPAC328.05 | NP_594207.3 | RRM | 71..387 | CDD:223796 | 45/210 (21%) |
RRM_SF | 79..150 | CDD:240668 | 15/71 (21%) | ||
RRM3_hnRNPM_like | 181..252 | CDD:240833 | 17/78 (22%) | ||
RRM_SF | 312..385 | CDD:302621 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |