DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and SPBC1861.04c

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_596721.1 Gene:SPBC1861.04c / 2539617 PomBaseID:SPBC1861.04c Length:1014 Species:Schizosaccharomyces pombe


Alignment Length:193 Identity:38/193 - (19%)
Similarity:80/193 - (41%) Gaps:37/193 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHK 88
            |:|::..:|::..:..::..|..:|.:..|.:.|  :..:.:|||::..:.:...:||.:|...:
pombe   757 RELYVTNIDFKVNEKDVETFFRDYGQVESVRIPK--RFNQHKGFGYVVMTTNQDAENALSAAGKQ 819

  Fly    89 IDGRTVEPKRAVPRQEID----SPNAGATVKKLF------------------------VGGLRDD 125
            :..|.:....:.||:.::    |.|...|:.|.|                        |..:...
pombe   820 LGNRVLNVVLSKPRESLEKTRVSSNDNRTLAKSFETTESNKMSTPKKSFEQIKSKSLGVTNVDGT 884

  Fly   126 HDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQ-KTHSIKNKTLDV 187
            .:|..||..|:.:|::..| ::..:..|     |.:||.|.....|..|. :.|.|..:.|.:
pombe   885 VNEARLRSLFESYGKLYRV-VLHPEHEG-----AVVEFLDIHDAGKASLALEGHEIGGRLLHI 941

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 13/76 (17%)
RRM_SF 116..188 CDD:302621 19/97 (20%)
SPBC1861.04cNP_596721.1 RRM1_Prp24 590..662 CDD:240742
RRM2_Prp24 666..743 CDD:240743
RRM3_Prp24 757..829 CDD:240744 14/73 (19%)
RRM4_Prp24 874..943 CDD:240745 17/74 (23%)
Lsm_interact 996..1014 CDD:283133
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.