DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and RBM34

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_055829.2 Gene:RBM34 / 23029 HGNCID:28965 Length:430 Species:Homo sapiens


Alignment Length:235 Identity:52/235 - (22%)
Similarity:89/235 - (37%) Gaps:69/235 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DDGEEIT-----------EPEQL---RKLFIGGLDYRTTDDGLKAHFEKWGNIVDV--------- 53
            ||.|:..           |.|:|   |.:|:|.|........||:.|:::|.|..|         
Human   159 DDTEDTVVSQRKKIQINQEEERLKNERTVFVGNLPVTCNKKKLKSFFKEYGQIESVRFRSLIPAE 223

  Fly    54 ------------------------VVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTV 94
                                    ||.|:....          :|:...:.||.|     ||..:
Human   224 GTLSKKLAAIKRKIHPDQKNINAYVVFKEESAA----------TQALKRNGAQIA-----DGFRI 273

  Fly    95 EPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFA 159
                   |.::.|..:....:.:|||.|....:|..:.::|.|.|.|::|.||.||.||..:||.
Human   274 -------RVDLASETSSRDKRSVFVGNLPYKVEESAIEKHFLDCGSIMAVRIVRDKMTGIGKGFG 331

  Fly   160 FIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMDRQ 199
            ::.|::.|.|...:......:..:.|.|.:::.|:...:|
Human   332 YVLFENTDSVHLALKLNNSELMGRKLRVMRSVNKEKFKQQ 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 18/109 (17%)
RRM_SF 116..188 CDD:302621 22/71 (31%)
RBM34NP_055829.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..123
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..153
RRM 176..>382 CDD:223796 49/218 (22%)
RRM1_RBM34 185..276 CDD:240840 20/112 (18%)
RRM2_RBM34 288..360 CDD:240841 22/71 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..395 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..430
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.