DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and ELAVL3

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_024307178.1 Gene:ELAVL3 / 1995 HGNCID:3314 Length:424 Species:Homo sapiens


Alignment Length:255 Identity:59/255 - (23%)
Similarity:99/255 - (38%) Gaps:71/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SNGNYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFIT 71
            :||..||.:        ..|.:..|....|.|..|:.|...|:|....:::|..|.:|.|:||:.
Human    30 TNGATDDSK--------TNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVN 86

  Fly    72 YSQSYMIDNAQNA-RPHKIDGRTVEPKRAVPRQEIDSPNAGATVK--KLFVGGLRDDHDEECLRE 133
            ||.....|.|.|. ...|:..:|::...|.|        :.|:::  .|:|.||.....::.:.:
Human    87 YSDPNDADKAINTLNGLKLQTKTIKVSYARP--------SSASIRDANLYVSGLPKTMSQKEMEQ 143

  Fly   134 YFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMDR 198
            .|..:|:|::..|:.|:.||                                   :|:      |
Human   144 LFSQYGRIITSRILVDQVTG-----------------------------------QAV------R 167

  Fly   199 QGG-GGGRGGPRAGGR---------GGQGDRGQGGGGWGGQNRQNGGG-NWGGAGGGGGF 247
            :|. |||.|..::||.         |.:..:|:.|....||.|::|.. ...|...|.||
Human   168 EGAPGGGAGQRQSGGTNVGKPTKMPGHEAGKGEVGLHRRGQGRRDGHPCPLAGVSRGVGF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 22/77 (29%)
RRM_SF 116..188 CDD:302621 11/71 (15%)
ELAVL3XP_024307178.1 RRM 36..423 CDD:330708 56/249 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.