DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and ELAVL1

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001410.2 Gene:ELAVL1 / 1994 HGNCID:3312 Length:326 Species:Homo sapiens


Alignment Length:266 Identity:58/266 - (21%)
Similarity:98/266 - (36%) Gaps:47/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SNGNYDD--GEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGF 69
            ||| |:|  .|:.........|.:..|....|.|.|::.|...|.:....:::|.....|.|:||
Human     2 SNG-YEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGF 65

  Fly    70 ITYSQSYMIDNAQNA-RPHKIDGRTVEPKRAVPRQEIDSPNAGATVK--KLFVGGLRDDHDEECL 131
            :.|..:...:.|.|. ...::..:|::...|.|..|:        :|  .|::.||.....::.:
Human    66 VNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSSEV--------IKDANLYISGLPRTMTQKDV 122

  Fly   132 REYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQ-----------------KTHS 179
            .:.|..||:|::..::.|:.||..||.|||.||.....::.|..                 ..:.
Human   123 EDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANP 187

  Fly   180 IKNKTLDVKKAIAKQDMDRQGGG----------GGRGGPRAGGRGGQGDRGQGGGGWG------G 228
            .:||.:.:...:......|.||.          ...|.....|..|....|....||.      |
Human   188 NQNKNVALLSQLYHSPARRFGGPVHHQAQRFRFSPMGVDHMSGLSGVNVPGNASSGWCIFIYNLG 252

  Fly   229 QNRQNG 234
            |:...|
Human   253 QDADEG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 17/77 (22%)
RRM_SF 116..188 CDD:302621 20/88 (23%)
ELAVL1NP_001410.2 ELAV_HUD_SF 19..326 CDD:273741 52/248 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.