DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and rnp-9

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001359585.1 Gene:rnp-9 / 182350 WormBaseID:WBGene00007396 Length:312 Species:Caenorhabditis elegans


Alignment Length:195 Identity:45/195 - (23%)
Similarity:89/195 - (45%) Gaps:47/195 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKID 90
            :|:|.|....:::.||:.|.|:|.:.:..|::|.:|::|:|:||:::...   .||:||.. .::
 Worm    89 VFVGDLSKDVSNELLKSTFTKFGEVSEAKVIRDVQTQKSKGYGFVSFPNK---QNAENAIA-GMN 149

  Fly    91 GRTVEPKRAVP------------------RQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKD 137
            |:.: .||||.                  .|..:|..|..|  .::||.:.....:..||:.|..
 Worm   150 GKWI-GKRAVRTNW
AARKNSEENRDKLTFEQVFNSTKADNT--SVYVGNISQQTTDADLRDLFST 211

  Fly   138 FGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQ----------------KTHSIKNKTLD 186
            :|.|..|.|.      |.:.:||:.::..:...|.|::                :|.::.|:.|:
 Worm   212 YGDIAEVRIF------KTQRYAFVRYEKKECATKAIMEMNGKEMAGNQVRCSWGRTQAVPNQALN 270

  Fly   187  186
             Worm   271  270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 24/93 (26%)
RRM_SF 116..188 CDD:302621 17/87 (20%)
rnp-9NP_001359585.1 RRM2_TIA1_like 88..162 CDD:240799 24/77 (31%)
RRM3_TIA1_like 189..260 CDD:240800 15/78 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.