DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and hrpa-2

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_741783.1 Gene:hrpa-2 / 180791 WormBaseID:WBGene00019249 Length:336 Species:Caenorhabditis elegans


Alignment Length:198 Identity:72/198 - (36%)
Similarity:114/198 - (57%) Gaps:33/198 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QNDSNGNYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFG 68
            |:||            |.||||||||||.:.|||:.|..:|.:||.:||.:|::||.||.|||||
 Worm    62 QHDS------------PPQLRKLFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFG 114

  Fly    69 FITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDS----------PNAGATVKKLFVGGLR 123
            |:|::..:..::|.|.||||:.|:||:.|||:||:::.|          |..|.   ||.:.|:.
 Worm   115 FVTFASIFSAESAMNDRPHKLGGKTVDSKRAIPREQMSSMIPPPFFETDPAPGC---KLLLNGIT 176

  Fly   124 DD-HDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKT--HSIKNKTL 185
            :. |..:.||.||:.||.:..|.|:     |:.||..|:.::|.:..|:.:...:  |.:..:.:
 Worm   177 NGVHSVDSLRVYFETFGTLDQVEIL-----GQPRGLGFVIYEDKESADRCLAHNSGRHIVNERKI 236

  Fly   186 DVK 188
            :|:
 Worm   237 EVR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 40/76 (53%)
RRM_SF 116..188 CDD:302621 19/74 (26%)
hrpa-2NP_741783.1 RRM <62..230 CDD:223796 70/187 (37%)
RRM1_hnRNPA_like 71..148 CDD:241022 40/76 (53%)
RRM_SF 183..240 CDD:302621 16/62 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I5263
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.