Sequence 1: | NP_001163602.1 | Gene: | Hrb87F / 48535 | FlyBaseID: | FBgn0004237 | Length: | 385 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_741783.1 | Gene: | hrpa-2 / 180791 | WormBaseID: | WBGene00019249 | Length: | 336 | Species: | Caenorhabditis elegans |
Alignment Length: | 198 | Identity: | 72/198 - (36%) |
---|---|---|---|
Similarity: | 114/198 - (57%) | Gaps: | 33/198 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 QNDSNGNYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFG 68
Fly 69 FITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDS----------PNAGATVKKLFVGGLR 123
Fly 124 DD-HDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKT--HSIKNKTL 185
Fly 186 DVK 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hrb87F | NP_001163602.1 | RRM1_hnRNPA_like | 25..102 | CDD:241022 | 40/76 (53%) |
RRM_SF | 116..188 | CDD:302621 | 19/74 (26%) | ||
hrpa-2 | NP_741783.1 | RRM | <62..230 | CDD:223796 | 70/187 (37%) |
RRM1_hnRNPA_like | 71..148 | CDD:241022 | 40/76 (53%) | ||
RRM_SF | 183..240 | CDD:302621 | 16/62 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 84 | 1.000 | Domainoid score | I5263 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |