DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and rbm-34

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_502291.1 Gene:rbm-34 / 178148 WormBaseID:WBGene00008688 Length:394 Species:Caenorhabditis elegans


Alignment Length:226 Identity:52/226 - (23%)
Similarity:89/226 - (39%) Gaps:43/226 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EQNDSN--GNYDDGEEITEPEQLRK-------------LFIGGLDYRTTDDGLKAHFEKWGNIVD 52
            |:.|.|  |..|..:: .|...|:|             :|:|.:.....:..::..|..:|.|..
 Worm   108 EKKDENKEGKRDRTKQ-RENRTLQKSNARASAAENALTVFVGNMPLTMNEKSVRRIFSDFGTISS 171

  Fly    53 V-----VVMKDPKTKR-------------SRGFGFITYSQSYMIDNAQNARPHKIDGRTVE-PKR 98
            |     :...:..|||             |..| ::.:.....::.|......|:|...:. .|.
 Worm   172 VRMRNLLPANEKLTKRVTHLTGKLNDKQSSLTF-YVKFGAEESVEKALKYNGTKLDDHVIRVDKV 235

  Fly    99 AVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFK-DFGQIVSVNIVSDKDTGKKRGFAFIE 162
            ...::|.....|      :|||.|..:..|:.|..:|. ..|.:.:|.||.||||||.:||||:.
 Worm   236 GSKKKEFGKDMA------IFVGNLPFEITEDALITFFSAQIGPVEAVRIVRDKDTGKGKGFAFVN 294

  Fly   163 FDDYDPVDKIILQKTHSIKNKTLDVKKAIAK 193
            |.....|...:..:|..::.:.|.:.|.:.|
 Worm   295 FKQDSSVSLALSMETIKMEKRDLRITKVMKK 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 16/108 (15%)
RRM_SF 116..188 CDD:302621 25/72 (35%)
rbm-34NP_502291.1 RRM1_RBM34 144..233 CDD:240840 14/89 (16%)
RRM2_RBM34 247..320 CDD:240841 26/78 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.